Protein Alignment CSN5 and COPS6

DIOPT Version :9

• Sequence 1: NP_477442.1
• Gene: CSN5 / 42000
• FlyBaseID: FBgn0027053
• Length: 327
• Species: Drosophila melanogaster
• Sequence 2: NP_006824.2
• Gene: COPS6 / 10980
• HGNCID: 21749
• Length: 327
• Species: Homo sapiens
• Alignment Length: 71
• Identity: 20/71 - (28%)
• Similarity: 35/71 - (49%)
• Gaps: 3/71 - (4%)

  Fly    64 MHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRME 128
            |.::.|..::|:|.::||.|...:.||::|.|.....|.::....   ||.....|..|:|.:..
Human    58 MRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDK---EYYYTKEEQFKQVFKEL 119

  Fly   129 HAVGWY 134
            ..:|||
Human   120 EFLGWY 125

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CSN5	NP_477442.1	MPN_RPN11_CSN5	41..305	CDD:163700	20/71 (28%)
COPS6	NP_006824.2	MPN_CSN6	39..321	CDD:163694	20/71 (28%)
		Interaction with Vpr	211..327

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1310
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810