Sequence 1: | NP_477442.1 | Gene: | CSN5 / 42000 | FlyBaseID: | FBgn0027053 | Length: | 327 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001340896.1 | Gene: | STAMBP / 10617 | HGNCID: | 16950 | Length: | 424 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 42/206 - (20%) |
---|---|---|---|
Similarity: | 78/206 - (37%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARS 68
Fly 69 GGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEH---- 129
Fly 130 -AVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDP-------VRTVSAGKVCLGAFRTY 186
Fly 187 PKGYKPPNEEP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CSN5 | NP_477442.1 | MPN_RPN11_CSN5 | 41..305 | CDD:163700 | 35/169 (21%) |
STAMBP | NP_001340896.1 | Interaction with CHMP3 | 1..127 | ||
USP8_dimer | 7..114 | CDD:312504 | |||
Interaction with STAM | 227..231 | ||||
MPN_AMSH_like | 254..424 | CDD:163697 | 36/185 (19%) | ||
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 | 335..348 | 5/12 (42%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |