DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and PSMD14

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_005796.1 Gene:PSMD14 / 10213 HGNCID:16889 Length:310 Species:Homo sapiens


Alignment Length:255 Identity:95/255 - (37%)
Similarity:143/255 - (56%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KDIKISALALLKMVMHARSGGTLEVMGLMLGK-VEDNTMIVMDAFALPVEGTETRVNAQAQAYEY 113
            :.:.||:||||||:.|.|:|..:||||||||: |:|.|:.|:|.||:|..||...|.|....:: 
Human    29 EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQ- 92

  Fly   114 MTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKV 178
             ...::..|:.||.|..|||||||||:||||||:|::||...:...|..||:||||:::|. |||
Human    93 -AKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVK-GKV 155

  Fly   179 CLGAFRTYPKGYKPPNEEPSEYQTIP----LNK------IEDFGVHCKQYYPLEISYFKSALDRR 233
            .:.|||...........||.  ||..    |||      |.....|   ||.:.|:|.|:.|:::
Human   156 VIDAFRLINANMMVLGHEPR--QTTSNLGHLNKPSIQALIHGLNRH---YYSITINYRKNELEQK 215

  Fly   234 LLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLS 293
            :|.:|..|.|:..|   .|...:|:.......:.|.||.::|: .:..:..:|.:.::|:
Human   216 MLLNLHKKSWMEGL---TLQDYSEHCKHNESVVKEMLELAKNY-NKAVEEEDKMTPEQLA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 95/255 (37%)
PSMD14NP_005796.1 MPN_RPN11_CSN5 21..286 CDD:163700 95/255 (37%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 113..126 11/12 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031881at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.