DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and brcc3

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_009293985.1 Gene:brcc3 / 100333845 ZFINID:ZDB-GENE-100215-1 Length:287 Species:Danio rerio


Alignment Length:252 Identity:60/252 - (23%)
Similarity:108/252 - (42%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTA 116
            :.:.:.|.|..:.||.|....|||||.:|:|:.|.::.:.:..:.....:.:...:....:...|
Zfish    33 VHLESDAFLVCMNHALSTEKEEVMGLCIGEVDTNRIVHIHSVIILRRSDKRKDRVEISPEQLSAA 97

  Fly   117 YMEA---AKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVD---PVRTVSA 175
            ..||   |:..||....||||||||....|.|.:||.||.:.|...:.||.::..   ..:....
Zfish    98 STEAERLAEMTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKT 162

  Fly   176 GKVCLGAFRTYPKGYKPPNEEPSEYQ--TIPLNKI--EDFGVHCKQYYPLEISYFKSALD----- 231
            |:|....|::...      ::.|||:  .||::.:  |..|..|          .:||::     
Zfish   163 GRVLYTCFQSVQA------QKGSEYERIEIPIHVVPHEAIGKVC----------LESAVELPRIL 211

  Fly   232 --------RRL-----LDSLWNKYWVNTLGSSGLLTNTEYTTGQIMD-LSEKLEQSE 274
                    ||:     ||.: .|....::.:..|.:.....:|.::. |.::|||::
Zfish   212 CQEEQDTYRRIHSLTHLDPI-TKIHNGSVFTKNLCSQMSAISGPLLQWLEDRLEQNK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 60/252 (24%)
brcc3XP_009293985.1 MPN_BRCC36 30..267 CDD:163699 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.