DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and stambp

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001120237.1 Gene:stambp / 100145287 XenbaseID:XB-GENE-5926871 Length:416 Species:Xenopus tropicalis


Alignment Length:138 Identity:34/138 - (24%)
Similarity:55/138 - (39%) Gaps:26/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEH-----AV 131
            :|..|::.||:..|...|          |...|..|:...:|...  |:.:|:..::.     .:
 Frog   271 VETCGILCGKLMQNEFTV----------THVIVPKQSGGPDYCNT--ESEEELFLIQDQQGLITL 323

  Fly   132 GWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDP-------VRTVSAGKVCLGAFRTYPKG 189
            ||.|:||....:||.:|:.|....|......||||..|       .:....|...:|..|  .||
 Frog   324 GWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDYGMKEIGDCR--QKG 386

  Fly   190 YKPPNEEP 197
            :.|..::|
 Frog   387 FHPHCKDP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 34/138 (25%)
stambpNP_001120237.1 USP8_dimer 13..115 CDD:286108
MPN_AMSH_like 246..416 CDD:163697 34/138 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.