DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GDE1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_015215.1 Gene:GDE1 / 855994 SGDID:S000006031 Length:1223 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:53/282 - (18%)
Similarity:89/282 - (31%) Gaps:100/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKINVAQ----------------PLVELQKLN 145
            :|||:.|.||              |.:.::.....:|.::                .|:..|::.
Yeast   307 NKAALSKSLA--------------CIDAILKVIPSLNDSEDINRRNFFHHHIIAIGKLIRKQEIL 357

  Fly   146 ITEQHPMGSQY---EAETVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFMTADESFTQ 207
            ..::....|:|   |.|.|..||.|...|.|.|...:            |.|.:|......|:..
Yeast   358 SRKKKSQPSKYTNSEGEIVTDLRTLHTTLSAPAESDS------------ITEEEKSSACTLSYIL 410

  Fly   208 RTIVI------------SRSPL---AIYQLRKLKPEII-----CGLWHE---------------T 237
            ..:.|            .|:||   ..|.|.::...||     ..:|:|               |
Yeast   411 EELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLT 475

  Fly   238 YLSLAILKSSTLITSIYGAIFRNIIAPVIGISVVFLSKDEINFHIADLWRNVGVRPIVYMVNSPN 302
            .|.|.:|.:....|.    :....:.|.:.:      |.....|:|..|.|.   |:::::.|  
Yeast   476 PLHLCVLGAHPKTTE----VLLQSLDPNVKL------KSSSLLHLATEWNNY---PLLHVLLS-- 525

  Fly   303 EKRYFQKTMKIQYLTDSLRSEP 324
                 .|...|.|..:.|...|
Yeast   526 -----SKRFDINYQDNELHETP 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 51/275 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 51/276 (18%)
GDE1NP_015215.1 COG5408 1..300 CDD:227695
ANKYR 361..594 CDD:223738 43/214 (20%)
ANK repeat 427..466 CDD:293786 9/38 (24%)
ANK repeat 468..501 CDD:293786 6/36 (17%)
ANK repeat 506..535 CDD:293786 9/38 (24%)
Ank_2 508..603 CDD:403870 11/45 (24%)
ANK repeat 540..569 CDD:293786 1/3 (33%)
ANK repeat 572..603 CDD:293786
GDPD_YPL110cp_fungi 871..1219 CDD:176548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.