DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and PGC1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_015118.1 Gene:PGC1 / 855895 SGDID:S000006127 Length:321 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:49/256 - (19%)
Similarity:93/256 - (36%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKINVAQPLVELQKLNITE 148
            :.:||.....|||:..|.:|..|.|...:..|..:||.|.:||                    ..
Yeast     5 VGHRAFKARYPENTLLAFEKAYAAGADVIETDLQMTSDGMVVV--------------------NH 49

  Fly   149 QHPMGSQYEAETVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFMT-----------AD 202
            ....|..::...|         :.....|....||..::.:..:..|::.:|           .|
Yeast    50 DSDTGRMWDKNLV---------IGESTWEEVKRLRCKEDGSLAMMTLKEILTWAVCHPGAKLMLD 105

  Fly   203 ESFTQRTIVISRSPLAIYQLRK-LK---PEIICGL----WHETYLSLAILKS-STLITSIYGAIF 258
            ..||...|::.::.:.:.:::. ||   ..|..||    |::..:...:||. ..::.|:...|.
Yeast   106 IKFTNEKIIMIKTFVIMLEVKNDLKFWQERITWGLWLLDWYDFGIETGVLKDFKVIVISLSLDIA 170

  Fly   259 RNIIA----------PVIGISVVFLSKDEINFH---IADLWRNVGVRPIVYMVNSPNEKRY 306
            ...:.          .:.||||.|:|.....|.   :..|.:| .::..::.||.|.:.:|
Yeast   171 SQFVKRSLTLNDPHYKLFGISVHFVSSWTSQFRLRLLPVLMKN-DIKVYLWTVNKPIDFKY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 49/256 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 49/256 (19%)
PGC1NP_015118.1 GDPD_YPL206cp_fungi 4..244 CDD:176512 49/256 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4508
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.