DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and PHO81

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_011749.3 Gene:PHO81 / 853148 SGDID:S000003465 Length:1178 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:37/183 - (20%)
Similarity:61/183 - (33%) Gaps:66/183 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 YWPIANRAAGFDAPENSK---AAIKKCLARGYRNVLLDAGLTSCG---EIVVANPTKINVAQPLV 139
            ||    ::.|.|...:||   ......|...:.:||:      |.   |.:||.|      :|.|
Yeast   877 YW----KSTGSDLMTSSKDGNFVTSSSLNGSFISVLV------CALNDETIVAAP------KPYV 925

  Fly   140 EL------------QKLNITEQHPMG-----------SQYEAETVAPLRQLSDFLEAEA------ 175
            |.            ::|.....:..|           .||.:..|.|||.|.:.:...|      
Yeast   926 EFKGTKILLNDLTKEQLEKVVDYDFGKIDGSFDEVTLKQYLSSRVVPLRSLLEVIPGSAQLVIRV 990

  Fly   176 ------------AETTVFLRLH---DNSARMINELQKFMTADESFTQRTIVIS 213
                        .:.:.|:.::   |....:|.|.::|:....|.:.|.||.|
Yeast   991 YFPTDKEIDTIPIKISPFININQFIDKLLLIIFEHERFLRHSGSGSMRQIVFS 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 35/181 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 35/180 (19%)
PHO81NP_011749.3 SPX_PHO81_NUC-2_like 2..159 CDD:269904
Ank_2 411..482 CDD:403870
ANK repeat 423..456 CDD:293786
ANK repeat 458..495 CDD:293786
PHA02875 466..>650 CDD:165206
ANK repeat 508..540 CDD:293786
Ank_2 561..647 CDD:403870
ANK repeat 561..588 CDD:293786
ANK repeat 590..622 CDD:293786
GDPD_NUC-2_fungi 875..1172 CDD:176520 37/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.