DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GDPD4

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_177290.3 Gene:GDPD4 / 843475 AraportID:AT1G71340 Length:328 Species:Arabidopsis thaliana


Alignment Length:106 Identity:21/106 - (19%)
Similarity:41/106 - (38%) Gaps:26/106 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LRQLSDFLEAEAAETT--VFLRLHDNSARMINELQKFMTADESFTQRTIVISRSPLAIYQLRKLK 226
            :|...|.:|.:.:.::  |...||:...:.|.........|              |::.|:::|.
plant    97 IRSRVDCIEVDVSRSSDGVLFALHNRDLQRIARNSSVQVGD--------------LSMKQIKELD 147

  Fly   227 -PEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVI 266
             .||:.|       :|...:..||..::  |:..|.:..||
plant   148 VSEIVKG-------TLGSSRIPTLEEAL--ALISNSVRKVI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 21/106 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 21/106 (20%)
GDPD4NP_177290.3 GDPD 75..304 CDD:176499 21/106 (20%)
GDPD 78..305 CDD:281062 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218115at2759
OrthoFinder 1 1.000 - - FOG0002161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101668
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.