DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd2

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001292870.1 Gene:Gdpd2 / 71584 MGIID:1918834 Length:539 Species:Mus musculus


Alignment Length:264 Identity:55/264 - (20%)
Similarity:95/264 - (35%) Gaps:84/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRLLWLALKMIYQ---------------LLCCSVSLIFFCFN-------VFWLFCNLAIPWCTLT 46
            ||..|.:|::..|               ||...|:..|:..:       :..||..:.:....:.
Mouse   142 WRQEWHSLRLSLQATAPFLHIGAVAGITLLAWPVADTFYRIHPRGPKVLLLLLFFGVTLVIYLMP 206

  Fly    47 LLVV---CIASKFVKLQRSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAIKKCLARG 108
            ||.:   ||    :||:..|.:..|               :.:|.|...||||:..:::|....|
Mouse   207 LLFISSPCI----MKLRDLPPKPGL---------------VGHRGAPMLAPENTLMSLRKTAECG 252

  Fly   109 YRNVLLDAGLTSCGEIVVANPTKI----NVAQPL-------------VELQKLN----ITEQHPM 152
            ......|..::|.|...:.:..::    |||...             .|||:||    ..|:.|.
Mouse   253 AAVFETDVMVSSDGVPFLMHDERLSRTTNVASVFPERISAHSSDFSWAELQRLNAGTWFLERQPF 317

  Fly   153 -------GS---QYEAETVAPLRQLSDFLEAEAAETTVFL------RLHDNSARMINE-LQKFMT 200
                   ||   :.|.:|:..|.:|  ..||.|...::..      |.|......:|: |:..::
Mouse   318 WGAKKLSGSDRKEAENQTIPALEEL--LKEAAALNLSIMFDLRRPPRNHTYYDTFVNQTLEAVLS 380

  Fly   201 ADES 204
            |:.|
Mouse   381 ANVS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 36/160 (23%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 36/159 (23%)
Gdpd2NP_001292870.1 PI-PLCc_GDPD_SF 198..500 CDD:417475 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.