DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd3

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_077190.2 Gene:Gdpd3 / 68616 MGIID:1915866 Length:330 Species:Mus musculus


Alignment Length:295 Identity:60/295 - (20%)
Similarity:111/295 - (37%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LLSSPEEWPSYWPI---ANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI 132
            ||.:|.  ...:||   |:|....:..||:..|::..:|:....:..|..||..|.:||::...:
Mouse    28 LLHTPR--APVFPIRLAAHRGGSGERLENTMEAVENSMAQRADLLEFDCQLTRDGVVVVSHDKNL 90

  Fly   133 NVAQPL-VELQKLNITEQHPMGSQYEAET---VAP----------LRQLSDFLEAEAAETTVFLR 183
            :....| .::..|:. |:.|:   |:.|.   .:|          :..|.|..: :...|.:.|.
Mouse    91 SRQSGLNKDVNTLDF-EELPL---YKEELEIYFSPGHFAHGSDRHMISLEDVFQ-KFPRTPMCLE 150

  Fly   184 LHDNSARMINELQKFMTADESFTQRTIVISRSPLAIYQLRKLKPEIICG--LWHE------TYLS 240
            :.:.:..:|:::.. :|......:.||..:.....:.:.|...||:...  :|..      .||.
Mouse   151 VKERNEELIHKVAN-LTRRFDRNEITIWAAEKSSVMKRCRAANPEMPMAFTIWRSFWILLLYYLG 214

  Fly   241 LAILKS----------STLITSIYGAIFR----NIIAPVI-----------------GISVVF-L 273
            |....|          .|:|...|.. ||    |.::..|                 |:.|:| .
Mouse   215 LLPFVSIPEKFFFCFLPTIINRTYFP-FRCGWMNQLSATITKWIIMRKSLIRHLQDRGVQVLFWC 278

  Fly   274 SKDEINFHIA-DLWRNVGVRPIVYMVNSPNEKRYF 307
            ..:|.:|.:| .|..| ||     |.:.|...|::
Mouse   279 LNEESDFEVAFSLGAN-GV-----MTDYPTALRHY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 57/283 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 56/282 (20%)
Gdpd3NP_077190.2 GDPD_GDE4 13..310 CDD:176553 60/295 (20%)
UgpQ 34..311 CDD:223657 57/287 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.