DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_079914.1 Gene:Gdpd1 / 66569 MGIID:1913819 Length:314 Species:Mus musculus


Alignment Length:308 Identity:63/308 - (20%)
Similarity:118/308 - (38%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WCTLTLLVVCIASKFVKLQ-----RSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAI 101
            :|.|:.|...:.:.|:.|:     ....::|.||.           .|::|....:..||:.||.
Mouse     7 FCLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSR-----------HISHRGGAGENLENTMAAF 60

  Fly   102 KKCLARGYRNVLLDAGLTSCGEIVVAN------PTKINVAQPLVE-------LQKLNITEQHPMG 153
            :..:..|...:.||..:|...::||::      .|.:||....::       |.||::..|....
Mouse    61 QHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDLKYCELPPYLCKLDVPFQRACK 125

  Fly   154 SQYEAETVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFMTADESFTQRTIVISRSPLA 218
            .:.: :|..||  |.:..|| ..||.:.:.:..|:..:|.::.:.:..          ..|..|.
Mouse   126 CEGK-DTRIPL--LKEVFEA-FPETPINIDIKVNNNVLIKKVSELVKQ----------YKREHLT 176

  Fly   219 IYQLRKLKPEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVIGISVVFLSKDEINFHIA 283
            ::  .....||:...:.|. ..:.||.|...:..|.|..|..:: |.:.|...|       |.| 
Mouse   177 VW--GNANSEIVDKCYKEN-SDIPILFSLQRVLLILGLFFTGLL-PFVPIREQF-------FEI- 229

  Fly   284 DLWRNVGVRPIVYMVNSPNEKRYFQKTMK-IQYLTDSLRSEPHLLMKA 330
                     |:..::....|.....|..| :.:|:|:|     |:.||
Mouse   230 ---------PMPSIILKLKEPHTISKGHKFLIWLSDTL-----LMRKA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 50/249 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 51/249 (20%)
Gdpd1NP_079914.1 GDPD_GDE4 14..311 CDD:176553 60/301 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.