DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd4b

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005161302.1 Gene:gdpd4b / 571892 ZFINID:ZDB-GENE-050309-133 Length:590 Species:Danio rerio


Alignment Length:450 Identity:92/450 - (20%)
Similarity:162/450 - (36%) Gaps:155/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRLLWLALKMIYQLLC--------CSVSLIFF--CFNVFWLFCNLA-----IPWCTLTLLVVCIA 53
            |...|:.:.:.:|:..        ..::|:.:  .|:||.|...::     :|:.| .::.:.:|
Zfish   168 WGREWMTVLLSFQVTAPYLHIGGVVLITLLSWPIAFHVFRLNMKVSRIAIMLPYMT-AIVSLYLA 231

  Fly    54 SKFVKLQRSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGL 118
            ...:|   ||..|...:|.|:|.      .|.:|.|...||||:..:.:..||.|...:..|..:
Zfish   232 PLGLK---SPCIKDSRNLGSAPA------LIGHRGAPMLAPENTYMSFEMALAAGADGLETDVTI 287

  Fly   119 TSCG----------------EIVVANPTKINVAQ-PLVELQKLN----ITEQHPM--------GS 154
            :..|                |.|..|.|.::.|. ...|||.||    ...|.|.        |.
Zfish   288 SYDGVPFLMHDKNLLRTTDVEDVFPNWTHVSPAMFTWRELQSLNAGSWFFSQDPFRTASSLSSGQ 352

  Fly   155 QYEA--ETVAPLRQLSDFLEAEAAETTVF----------LR----------LHDNSARMINELQK 197
            :.:|  ::|..||...| |.|:..:..||          .|          :|:.|:  |:..|.
Zfish   353 RLQAQNQSVCTLRSFLD-LAAQHGKLVVFDLYRPPRGHPYRDTWITQTLDVIHNQSS--IHSSQV 414

  Fly   198 FMTADE--SFTQ------RTIVISRSPLAIYQLRKLKPEIICGLWHETYLSLAILK---SSTLIT 251
            .....|  .|.|      :.|...::|:...|||::....|    |.:.:|...::   ::.:.|
Zfish   415 LWLPPELRDFVQELDPELQQITHEQAPVEELQLRRIARLNI----HYSSMSETEIRKYAAANIST 475

  Fly   252 SIY--------------GA---------IFRNI--------------------IAPVIGISVVFL 273
            ::|              ||         |.:.:                    |..:|.|.::|:
Zfish   476 NLYVVSEPWLYSLAWCSGAHSVATNAVHILKKLQRPLFLMTPDEYRLMWTLTDITSLILIMMIFM 540

  Fly   274 SKDEINFHIADLWRNVGVRPIVYMVNSPNE-----KRYFQKTMK-IQYLTDSLRSEPHLL 327
                  ||   .||.   |.:...||:.:|     .|.|:..:. :.:|::...||.|.|
Zfish   541 ------FH---WWRE---RVLAISVNNSSELDNGSYRQFRAELNDVWFLSNMNGSEKHEL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 70/346 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 70/346 (20%)
gdpd4bXP_005161302.1 UPF0182 68..>208 CDD:329052 7/39 (18%)
PI-PLCc_GDPD_SF 228..543 CDD:326331 69/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101668
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.