DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd3b

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_017213986.2 Gene:gdpd3b / 567286 ZFINID:ZDB-GENE-121210-2 Length:320 Species:Danio rerio


Alignment Length:360 Identity:72/360 - (20%)
Similarity:128/360 - (35%) Gaps:124/360 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IPWCTLTLLVVCIASKF-----VKLQRSP----NEKRLLSLLSSPEEWPSYWPIANRAAGFDAPE 95
            :.|    :|::|:|..|     :.|.|.|    ..|||       |.:..:  |::|....:..|
Zfish     4 VSW----VLLLCLAVLFYVVCSLFLLRYPLILHKRKRL-------EFYCRH--ISHRGGSGERIE 55

  Fly    96 NSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI--------NVAQ------PLVELQKLNI 146
            |:..|....::.|...:.:|..||..|.:||::...:        .|:.      ||.| :||.:
Zfish    56 NTMEAFTHAVSAGTDMLEMDCHLTLDGYVVVSHDNNLLRQTGDDKTVSSLKFQDLPLYE-EKLEV 119

  Fly   147 T------------------------EQHPMGSQYEAETVAPLRQLSDFLEAEAAE-TTVFL-RLH 185
            |                        ...||..:.:......::::|:.:.....| .||:. ..|
Zfish   120 TFYVGHYSTGKDRRFVLLENVLKNFPNMPMTLEIKENNDLLIKKVSNLVHKYGREHITVWASEEH 184

  Fly   186 DNSARMI--NELQKFMTADESFTQRTIV---------------ISRSPLAIYQLRKLKPEIICGL 233
            :..|:.:  |....:|     ||.|.::               :..|.|..|     .|.||   
Zfish   185 EVMAKCLKQNPSMPYM-----FTMRRVIMLLLLFYTGLLPFVPLGESVLMFY-----LPRII--- 236

  Fly   234 WHETYL-SLAILKS-------STLITSIYGAIFRNIIAPVIGISV-VFLSKDEINFHIADLWRNV 289
             :.||: ..|.:|:       ..|||  :.::|.::|..  |:.| :|:..:|.:...|......
Zfish   237 -NRTYIPEEAYMKNRFVVYLLQKLIT--WKSLFEHLIKR--GLQVQLFVCNEETDMAAAFAMGAT 296

  Fly   290 GVRPIVYMVNSPNEKRYFQKTMKIQYLTDSLRSEP 324
            ||     |.:.|.            .|:|.:|..|
Zfish   297 GV-----MTDYPT------------VLSDYIRKHP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 57/301 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 58/301 (19%)
gdpd3bXP_017213986.2 GDPD_GDE4 17..312 CDD:176553 65/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.