DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd2

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005173341.1 Gene:gdpd2 / 563198 ZFINID:ZDB-GENE-081107-62 Length:523 Species:Danio rerio


Alignment Length:353 Identity:72/353 - (20%)
Similarity:118/353 - (33%) Gaps:117/353 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRLLWLALKMIYQ---------------LLCCSVSLIFFCFN--------VF----WLFCNLAIP 41
            |...|.|:.|.:|               ::.|   |:|..::        :|    :|..:.|:.
Zfish   132 WEKQWKAIYMSFQATAPFLQLSAVVALTVISC---LVFQSYHRAKTTACKIFIMMTFLVVSAAVF 193

  Fly    42 WCTLTLLVVCIASKFVKLQRSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAIKKCLA 106
            .|.|.:...||.|..      |.:..|               |.:|.|...||||:..:.:|.|.
Zfish   194 LCPLAICSPCITSNL------PPKPAL---------------IGHRGAPMLAPENTLMSFRKSLE 237

  Fly   107 RGYRNVLLDAGLT---------SCGEIVVANPTKINVAQP---------LVELQKLN----ITEQ 149
            .|......|..|:         .||:..:...|.:....|         |.||:.||    .:..
Zfish   238 FGVVAFETDVQLSKDKKPFLMHDCGKNFLLRTTDVKDKFPGRDGSNNFTLQELKTLNAGKWFSRS 302

  Fly   150 HP---MGSQYEAE-------TVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFMTADES 204
            .|   :.|..|.|       ||..|.:|.|.::.........|:..:||.       .|.::|..
Zfish   303 DPFWTLSSLSEEERREADNQTVPSLSELLDLVKKHNVSLIFDLKNENNST-------VFQSSDSF 360

  Fly   205 FTQRTI-VISRSPLAIYQLRKLKPEIICGLWHETYLSLAILKSSTLITSIY---------GAIFR 259
            :|..|| .:..||..|:.   |.||    ..|:      ::|.......:|         |..|.
Zfish   361 YTTETINKLGISPDKIWW---LPPE----YRHD------VMKMEPGFKQVYNKQKEMLMDGGNFM 412

  Fly   260 NI-IAPVIGISVVFLSKDEINFHIADLW 286
            |: .:.:..:.:..|.|..::   .:||
Zfish   413 NMNFSSLSALEISELRKSNVS---VNLW 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 54/247 (22%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 54/246 (22%)
gdpd2XP_005173341.1 GDPD_GDE3 188..501 CDD:176551 62/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.