DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GPCPD1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_062539.1 Gene:GPCPD1 / 56261 HGNCID:26957 Length:672 Species:Homo sapiens


Alignment Length:294 Identity:48/294 - (16%)
Similarity:103/294 - (35%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 YW------PIANRAAG--------FDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTK 131
            ||      .:.:|.||        ....||:.|:::...:.|...|..|                
Human   312 YWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD---------------- 360

  Fly   132 INVAQPLVELQKLNITEQHPMGSQYEAETV----APLRQLS-DFLEAEAAETTVFLRLHDNSARM 191
            :::::..|.:...::|....|..:::|:.|    .|:::|: |.|:.........|:..|....:
Human   361 VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKDRKESV 425

  Fly   192 INELQKFMTADESFTQRTIVISRSPLAIYQLRKLKPEIIC----GLWH---ETYLSLAILKSSTL 249
            :.|...| :.::.|....:|:...|..:....::|  .||    |:|.   .||..:.:.....|
Human   426 VQEENSF-SENQPFPSLKMVLESLPEDVGFNIEIK--WICQQRDGMWDGNLSTYFDMNLFLDIIL 487

  Fly   250 ITSIYGAIFRNIIAPVIGISVVFLSKDEINFHIADLWRNVGVRPIVYMVNSPNE----------- 303
            .|.:..:..|.|:.......:..:.:.:.|.:           ||:::....:|           
Human   488 KTVLENSGKRRIVFSSFDADICTMVRQKQNKY-----------PILFLTQGKSEIYPELMDLRSR 541

  Fly   304 -------KRYFQKTMKIQYLTDSLRSEPHLLMKA 330
                   ...|:..:.|...|:.|...|..:.:|
Human   542 TTPIAMSFAQFENLLGINVHTEDLLRNPSYIQEA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 43/273 (16%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 43/273 (16%)
GPCPD1NP_062539.1 CBM20_Prei4 4..127 CDD:99888
Substrate binding. /evidence=ECO:0000255 88..89
GDPD_GDE5 319..611 CDD:176549 46/287 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.