DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gde1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_062526.1 Gene:Gde1 / 56209 MGIID:1891827 Length:331 Species:Mus musculus


Alignment Length:307 Identity:73/307 - (23%)
Similarity:132/307 - (42%) Gaps:32/307 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CTLTLLVVCIASKFVKLQRSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAIKKCLAR 107
            |.||..:. |..:|...:..|: :|.|.:| .|.:..|  .||:|....|||||:.|||::....
Mouse    32 CVLTGSLY-ILLRFFSFEPVPS-RRALQVL-KPRDRVS--AIAHRGGSHDAPENTLAAIRQAAKN 91

  Fly   108 GYRNVLLDAGLTSCGEIVVANPTKINVAQ---------PLVELQKLNITEQHPMGSQYEAETVAP 163
            |...|.||...||.|..|:.:...::...         ...:::|||....|.:.:::..|.:..
Mouse    92 GATGVELDIEFTSDGVPVLMHDNTVDRTTDGSGRLCDLTFEQVRKLNPAANHRLRNEFPDERIPT 156

  Fly   164 LRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFMTADESFTQRTIVISRSPLAIYQLRKLKPE 228
            |::.  ..|......|:|..:..::......|:...|........::|.|..|..||::|:...:
Mouse   157 LKEA--VTECLRHNLTIFFDVKGHADMASAALKNIYTEFPQLYNNSMVCSFLPEVIYKMRQTDQK 219

  Fly   229 IICGLWHETYLSLA-----------ILKSSTLIT--SIYGAIFRNIIAPVIGISVVFLSKDEINF 280
            :|..|.|..: ||:           ..|.|..:.  .:......|::..:.|||...:.||.::.
Mouse   220 VITALTHRPW-SLSHTGDGKPRYSVFWKQSVFVVLDILLDWSMHNVLWYLCGISAFLMQKDFVSP 283

  Fly   281 HIADLWRNVGVRPIVYMVNSPNEKRYFQKTMKIQYLTDSLRSE--PH 325
            .....|...|::.:.:.||:.:||.|::..:...|:|||:..:  ||
Mouse   284 DYLKKWSAKGIQVVSWTVNTFDEKNYYESHLGSSYITDSMLEDCAPH 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 58/257 (23%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 59/257 (23%)
Gde1NP_062526.1 GDPD_GDE1 68..323 CDD:176515 59/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10703
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41149
Inparanoid 1 1.050 72 1.000 Inparanoid score I5289
Isobase 1 0.950 - 0 Normalized mean entropy S4508
OMA 1 1.010 - - QHG48100
OrthoDB 1 1.010 - - D1218115at2759
OrthoFinder 1 1.000 - - FOG0002161
OrthoInspector 1 1.000 - - oto91989
orthoMCL 1 0.900 - - OOG6_101668
Panther 1 1.100 - - LDO PTHR46320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.