DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd5b

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005157799.1 Gene:gdpd5b / 560645 ZFINID:ZDB-GENE-030131-6028 Length:584 Species:Danio rerio


Alignment Length:359 Identity:68/359 - (18%)
Similarity:117/359 - (32%) Gaps:109/359 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRLLWLALKMIYQLLCCSVSLIFFCFNVFWLFCNLAI--------PWCTLTLLVVCIASKFVKLQ 60
            |.::|::|:.....|  .:..:.....:.||......        ....|..|.|.:...|:.|.
Zfish   150 WDVVWISLQATGPFL--HIGALAAVTALAWLMAGQVARAEKTRFQAMVLLLYLSVLLTLYFIPLS 212

  Fly    61 -RSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCG-- 122
             .||......||.::|.      .|.::.|...||||:..:..:.|.|....:..|..::..|  
Zfish   213 ISSPCIMERGSLKAAPA------IIGHQGAPMLAPENTLLSFNRALQRNVSGLETDVTISLDGVP 271

  Fly   123 ------------------------EIVVANPT---KINVAQ------PLVELQKLNITEQHPMGS 154
                                    :..:.|.|   .:|..|      |...:|.::.||:..:|:
Zfish   272 FLMRDRTLRRTTNVRRVFPERQYEDASLFNWTDLSTLNAGQWFLKDDPFWTVQYMSTTERWSVGN 336

  Fly   155 QYEAETVAPLRQLSDFLEAEAAETTVF-----------------LRLHDNSARMINELQKFMTAD 202
            |    ||..|.|:.. |.|:...:.:|                 |.|.......|.:.|...|.|
Zfish   337 Q----TVCSLEQMLK-LAAKYKSSALFTVHRPPVNHPHHHDWVNLTLDTVLGSGIPQGQVMWTVD 396

  Fly   203 ESFTQRTIVISRSPLAIYQLRKLKPEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVIG 267
               :.|.:|           ||:.|.     :.:|  |:..|...||..:              |
Zfish   397 ---SNREMV-----------RKVAPG-----FQQT--SMQKLPFDTLHHN--------------G 426

  Fly   268 ISVVFLSKDEINFHIADLWRNVGVRPIVYMVNSP 301
            ||.:.|..::.:.....|::...:...:|.||.|
Zfish   427 ISRLLLRYNQASEQDVRLYKENNISVSLYTVNEP 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 52/271 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 52/270 (19%)
gdpd5bXP_005157799.1 ESSS <23..74 CDD:301731
GDPD_GDE2 227..582 CDD:176550 53/280 (19%)
GDPD 233..460 CDD:281062 50/266 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.