DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd5a

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_009303864.1 Gene:gdpd5a / 555247 ZFINID:ZDB-GENE-091204-253 Length:600 Species:Danio rerio


Alignment Length:307 Identity:60/307 - (19%)
Similarity:100/307 - (32%) Gaps:105/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SYWRLLWLALKMIYQLLCCSVSLI----FFC------FNVF-WLFCNLAIPW------------- 42
            |.|...|      :.|||||..|:    :|.      :|.| ||..|.:..|             
Zfish    38 SKWECSW------FFLLCCSFLLLLVWSYFWLEARNDYNEFNWLLYNRSAVWKDGTVPILATTLT 96

  Fly    43 -CTLTLLVVCIASKFVKLQRSPN-------------EKRLLSLLSSPEEWPSYWPIANRAAGFDA 93
             .|.|..::.:|...:.|.:..|             ...:..::|..:.|...|.|...:..|..
Zfish    97 GLTYTAFLMILALCHIALGQQLNLYWIHKIAVLAVFLTTITGVVSIDDFWQDEWDIVIISLQFTG 161

  Fly    94 PENSKAAIKKCLARGYRNVLLDAGLTSCGE---------------IVVANPTKINVAQP-LVELQ 142
            |.....|:....|.|:    :.|.....||               ::|.....:.::.| :::..
Zfish   162 PFLHIGALAAVTALGW----VIASQVVRGERSRLQVVTLAVYALILLVLYVVPLFISSPCIMDRS 222

  Fly   143 KLN-------------ITEQHPMGSQYEAETVAPLRQLSDFLEAEAA---ETTVFLRLHDNSARM 191
            ||.             :..:|.:.|..:|     |:|....|||:.|   :...|| :.|.:.|.
Zfish   223 KLGPRPAVIGRRGAPMLAPEHTLMSFSKA-----LQQKVTALEADVAISLDGVPFL-MRDRTLRR 281

  Fly   192 INELQKFMTA----DESFTQRTIVISRSPLAIYQLRKLKPEIICGLW 234
            ..::.:...|    |.||...|           ::|.|.    .|||
Zfish   282 TTDVDRLFPARQDTDASFFNWT-----------EIRSLN----AGLW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 36/188 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 36/187 (19%)
gdpd5aXP_009303864.1 PI-PLCc_GDPD_SF 227..582 CDD:301322 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.