DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001017323.1 Gene:gdpd1 / 550077 XenbaseID:XB-GENE-5612387 Length:317 Species:Xenopus tropicalis


Alignment Length:272 Identity:53/272 - (19%)
Similarity:101/272 - (37%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVAN------PTKINVAQPLVE-- 140
            |::|....:..||:.||.:..::.|...:.||..||...::||::      .|.:|:..|.:.  
 Frog    41 ISHRGGAGENLENTMAAFRHAVSLGTDMLELDCHLTKDEQVVVSHDGNLKRSTGVNLNIPDLNYC 105

  Fly   141 -----LQKLNITEQHPMGSQYEAETVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFM- 199
                 |.:|::|.:.....:...:...||  |.|..|| ..:|.:.:.:..|:..::.::...: 
 Frog   106 DLPPYLCQLDVTFEKDCCCRGGEDKSIPL--LKDVFEA-FPDTPINIDIKVNNNILVKKVSDLVR 167

  Fly   200 -----------TADESFTQRTIVISRS----PLAIYQLRKLKPEIICGLWHETYLSLAILKSSTL 249
                       .||....|:   ..|.    ||.....|.|   ::.||::...|....|:..  
 Frog   168 EYKREHLTVWGNADYDIVQK---CHRENCDIPLLFCFQRVL---LLVGLFYTGLLPFVPLREQ-- 224

  Fly   250 ITSIYGAIFRNIIAPVIGISVVFLSKDEINF---HIADLW---------------RNVGVRPIVY 296
                    |..|..|    |::...||....   |...:|               :..|::..::
 Frog   225 --------FLEIPMP----SIIMKLKDPSKMSRSHKFVVWLADALIMRKALFDHLKARGIQVYIW 277

  Fly   297 MVNSPNE-KRYF 307
            ::|:..| ||.|
 Frog   278 VLNNDEEYKRAF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 53/272 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 53/272 (19%)
gdpd1NP_001017323.1 GDPD_GDE4 12..310 CDD:176553 53/272 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.