DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GDPD2

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001164663.1 Gene:GDPD2 / 54857 HGNCID:25974 Length:590 Species:Homo sapiens


Alignment Length:192 Identity:44/192 - (22%)
Similarity:70/192 - (36%) Gaps:55/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTLLVVCIASKFVKLQRSPNEKRLLSLL---------------SSP------EEWPSYWPIANRA 88
            :.||...:|..|.::.|. ..|.||.||               |||      :..|....:.:|.
Human   168 IALLAWPVADTFYRIHRR-GPKILLLLLFFGVVLVIYLAPLCISSPCIMEPRDLPPKPGLVGHRG 231

  Fly    89 AGFDAPENSKAAIKK---CLAR-----------GYRNVLLDAGLTSCGEIVVANPTKINVAQ--- 136
            |...||||:..:::|   |.|.           |...::.|..|:....:....||:|....   
Human   232 APMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTNVASVFPTRITAHSSDF 296

  Fly   137 PLVELQKLN----ITEQHPM----------GSQYEAETVAPLRQLSDFLEAEAAETTVFLRL 184
            ...||::||    ..|:.|.          ..:.|::||..|.:|.:  ||.|...::...|
Human   297 SWTELKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLE--EAAALNLSIMFDL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 30/133 (23%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 30/132 (23%)
GDPD2NP_001164663.1 PI-PLCc_GDPD_SF 202..563 CDD:326331 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.