DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd5

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006229876.1 Gene:Gdpd5 / 499211 RGDID:1559673 Length:610 Species:Rattus norvegicus


Alignment Length:190 Identity:39/190 - (20%)
Similarity:72/190 - (37%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LTLLVVCIASKFVKLQRSPNEKRLLS--------------LLSSP------EEWPSYWPIANRAA 89
            :|.|...:|.:|.:.:||.::..:|.              .:|||      :..|....|.:|.|
  Rat   172 ITALSWIVAGQFARAERSSSQLTILCTFFAVVFTFYLVPLTISSPCIMEKKDLGPKPALIGHRGA 236

  Fly    90 GFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI----NVAQPLVELQK-----LN 145
            ...|||::..:.:|.|.:....:..|..::..|...:.:.|.:    ||.|...||.:     ||
  Rat   237 PMLAPEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEQVFPELARRPAAMLN 301

  Fly   146 ITEQHPMGSQ---------YEAETVAP----------LRQLSDFLEAEAAETTVFLRLHD 186
            .|....:.:.         :.|.:::|          :..|::.||......|:.|.|.|
  Rat   302 WTSLQRLNAGQWFLKTDPFWTASSLSPSDHREVENQSICSLAELLELAKGNATLLLNLRD 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 28/132 (21%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 28/131 (21%)
Gdpd5XP_006229876.1 PI-PLCc_GDPD_SF 227..581 CDD:417475 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.