DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gpcpd1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_021324084.1 Gene:gpcpd1 / 492483 ZFINID:ZDB-GENE-060503-472 Length:727 Species:Danio rerio


Alignment Length:126 Identity:30/126 - (23%)
Similarity:54/126 - (42%) Gaps:33/126 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TKINVAQ-----PLVELQKLNITEQHPMG-SQYEAETVAPLRQLSDFLEAEAA-----ETTVFLR 183
            :|:|:|:     |:...:|::.|.:...| .:.::..|..|:|:|.|..|.|.     .|.|.|.
Zfish     6 SKMNIAEAEKMLPITSGRKISRTNKKRTGVLKKDSNVVDHLQQVSSFSSASACVSVMDSTKVTLT 70

  Fly   184 LHDNSARMINEL---------------QKFMT---ADESFT--QRTIVISRSPLAIYQLRK 224
            :..::|  :.|:               ||.:|   |:|..|  :.||.:.|.....|:..|
Zfish    71 VRGSTA--LGEVIAVVGSCETLGSWCQQKAVTLQPAEEDGTLWRTTIHVPRGAETKYRYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 30/126 (24%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 30/126 (24%)
gpcpd1XP_021324084.1 CBM20_Prei4 65..186 CDD:99888 16/67 (24%)
GDPD_GDE5 378..668 CDD:176549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.