DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and CG3942

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster


Alignment Length:328 Identity:63/328 - (19%)
Similarity:112/328 - (34%) Gaps:93/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CTLT---LLVVCIASKFVKLQRSPNEKRLLSLLSSPEEWPSYW-------PIANRAAGFD----- 92
            |..|   |:.:|:  :::.::..||.:..||     ..:..||       .|.::.:|..     
  Fly   326 CASTHRPLMEMCV--RYLIIRPLPNFRCDLS-----HSYERYWRKNRLCMNIGHKGSGNTYRLGS 383

  Fly    93 --APENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANP-------TKINVAQPLVELQKLNITE 148
              ..||:....|:.:......|.:|..||...::||.:.       .::...:.|:|.|.|.|..
  Fly   384 DVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPSFEDLLENQDLLIFA 448

  Fly   149 QH--------PMGSQYEAETVA-PLRQLS-DFLEAEAAETTVFLRLH-----DNSA-RMINELQK 197
            ..        .||.....:.:| ||...| |.|:    |..| ||..     |.|. ||:.|.:.
  Fly   449 YENLNKLMLLAMGGSKRKDLIAVPLEAFSYDQLK----EVKV-LRFAGSKGCDKSCDRMLLEQRP 508

  Fly   198 F-----------MTADESFTQRTIVISRSPLAIYQLRKLKPEIICGLWHETYLSLAILKSSTLIT 251
            |           :..|..|.........:.:..::....||......:.:|.|.:.:.|:...  
  Fly   509 FPLLLDLLDEENLPVDMGFLIEIKWPQMTNMRRWESGSFKPTFDRNFYVDTILEIVLNKAGKR-- 571

  Fly   252 SIYGAIFRNIIAPVIGISVVFLSKDEINFHIADLWRNV----GVRPIVYMVNSPNEK-RYFQKTM 311
                             .:||.|.|      ||:...|    .|.|:..::..|:.. :|..:.:
  Fly   572 -----------------RIVFCSFD------ADICAMVRFKQNVYPVTLLLEDPHSPVQYADQRV 613

  Fly   312 KIQ 314
            .:|
  Fly   614 SVQ 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 53/278 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 53/277 (19%)
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 53/279 (19%)
GDPD 372..685 CDD:281062 52/275 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.