DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd3a

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_998366.1 Gene:gdpd3a / 406482 ZFINID:ZDB-GENE-040426-2279 Length:315 Species:Danio rerio


Alignment Length:245 Identity:46/245 - (18%)
Similarity:93/245 - (37%) Gaps:55/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI--NVAQPLVELQKLNI 146
            |::|....:..||:..|....:..|...:.||..||..|.::|::...:  ...|. |.:..||:
Zfish    42 ISHRGGSGERIENTIEAFTHAVEVGTEMLELDCHLTKDGFVMVSHDENLLRQTGQD-VSISSLNL 105

  Fly   147 TEQHPMGSQYEAE---------TVAPLRQLSDFLEAEAAETTVFLRLHDNSARMINELQKFM--- 199
            .:..|.....|..         :...|..|.|... :...|.|.:.:.:|:..:|.::.:.:   
Zfish   106 EDLPPYKETLEVTFKTGHFSTGSDRKLALLEDVFR-KFPHTAVNIEVKENNIVLIEKISELVKQY 169

  Fly   200 ---------TADESFTQRTIVISRS-PLAIYQLRKLK----------PEIICG----------LW 234
                     :.|.:..:....|:.| |....|.|.|:          |.:..|          ::
Zfish   170 NREGISVWASVDSTIMENCRKINSSMPYMFSQKRGLQLLLLYYTGLLPFVPLGESFLQFYFPPIF 234

  Fly   235 HETYL-SLAILKSSTLI-----TSIYGAIFRNIIAPVIGISV-VFLSKDE 277
            ::.|: ...||||..:|     .::..|:|:::...  ||.: :|:..:|
Zfish   235 NKAYIPDTEILKSRLVIFLIERLTMRKALFKHLRER--GIQIHLFVCNEE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 46/245 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 46/245 (19%)
gdpd3aNP_998366.1 GDPD_GDE4 13..310 CDD:176553 46/245 (19%)
GDPD 44..301 CDD:281062 45/243 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.