powered by:
Protein Alignment CG14883 and CG18135
DIOPT Version :9
Sequence 1: | NP_650547.1 |
Gene: | CG14883 / 41997 |
FlyBaseID: | FBgn0038432 |
Length: | 330 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788526.1 |
Gene: | CG18135 / 40073 |
FlyBaseID: | FBgn0036837 |
Length: | 770 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 20/70 - (28%) |
Similarity: | 29/70 - (41%) |
Gaps: | 10/70 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 WPSYWP---IANRAAG----FDAP---ENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI 132
||..|| :.:|..| .||| ||:.|:...........:.||..||:.|..|:.:...:
Fly 447 WPKSWPNLDVGHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFGL 511
Fly 133 NVAQP 137
..|.|
Fly 512 RTAPP 516
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0584 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.