DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and CG9394

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001286660.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster


Alignment Length:165 Identity:41/165 - (24%)
Similarity:60/165 - (36%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVSLIFFCFNVFWLFCNLAIPWCTLTLLVVCIAS---KFVKLQRSPNEKRLLSLLSSPEEWPSYW 82
            |.|..|..|.|.||..     .|.|.:...|..|   |:...:|....||...|:.:   :....
  Fly     4 SWSKTFAAFTVAWLSA-----LCLLPVETFCDTSYYEKYYAARRYVPLKRNAPLVFN---FTLTL 60

  Fly    83 PIANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI-NVAQPLVELQKLNI 146
            |.|::.|.|:.|    |.:      |...||   |....|..|:.|.|.| ||....||:.:.:.
  Fly    61 PDADQLASFERP----ALV------GNLPVL---GAWQAGRAVLLNRTAILNVWSASVEIPQNSS 112

  Fly   147 TEQHPMGSQYEAETVAPLRQLSDFLEAEAAETTVF 181
            .|.....:.........:|:....::|....||.|
  Fly   113 VEYRYFAAAVGQSGAVQIRRWESHVQARTFNTTKF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 25/100 (25%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 24/99 (24%)
CG9394NP_001286660.1 CBM20 47..169 CDD:301601 28/117 (24%)
GDPD_GDE5 345..630 CDD:176549
GDPD 349..632 CDD:281062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.