DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and CG9394

DIOPT Version :10

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster


Alignment Length:165 Identity:41/165 - (24%)
Similarity:60/165 - (36%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVSLIFFCFNVFWLFCNLAIPWCTLTLLVVCIAS---KFVKLQRSPNEKRLLSLLSSPEEWPSYW 82
            |.|..|..|.|.||..     .|.|.:...|..|   |:...:|....||...|:.:   :....
  Fly     4 SWSKTFAAFTVAWLSA-----LCLLPVETFCDTSYYEKYYAARRYVPLKRNAPLVFN---FTLTL 60

  Fly    83 PIANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI-NVAQPLVELQKLNI 146
            |.|::.|.|:.|    |.:      |...||   |....|..|:.|.|.| ||....||:.:.:.
  Fly    61 PDADQLASFERP----ALV------GNLPVL---GAWQAGRAVLLNRTAILNVWSASVEIPQNSS 112

  Fly   147 TEQHPMGSQYEAETVAPLRQLSDFLEAEAAETTVF 181
            .|.....:.........:|:....::|....||.|
  Fly   113 VEYRYFAAAVGQSGAVQIRRWESHVQARTFNTTKF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 PI-PLCc_GDPD_SF 84..320 CDD:472694 24/99 (24%)
CG9394NP_611548.1 CBM20 47..169 CDD:449530 28/117 (24%)
GDPD_GDE5 345..630 CDD:176549
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.