DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd3

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001292116.1 Gene:Gdpd3 / 293490 RGDID:1308386 Length:320 Species:Rattus norvegicus


Alignment Length:299 Identity:65/299 - (21%)
Similarity:112/299 - (37%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LLSSPEEWPSYWPI---ANRAAGFDAPENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTKI 132
            ||.:|  |...:.|   |:|....:..||:..||:..:|:....:..|..||..|.:||::...:
  Rat    28 LLHTP--WAPGFSIRLAAHRGGSGERLENTMEAIENSMAQRADLLEFDCQLTRDGVVVVSHDKNL 90

  Fly   133 NVAQPL-VELQKLNITEQHPMGSQYEAET---VAP----------LRQLSDFLEAEAAETTVFLR 183
            :....| .::..|:.. |.|:   |:.|.   .:|          :..|.|..: :...|.:.|.
  Rat    91 SRQSGLNKDINTLDFA-QLPL---YKEELEIYFSPGHFAHGSDRHMISLEDVFQ-KFPRTPMCLE 150

  Fly   184 LHDNSARMI------------NELQKFMTADESFTQR------------TIVISRSPLAIYQLRK 224
            :.:.:..:|            ||:..:.:...|..:|            ||..|...|.:|.|..
  Rat   151 IKEKNEELIHKVANMARRFNRNEITIWTSEKNSIMKRCKAANPEMPTAFTIWRSFWILLLYYLGL 215

  Fly   225 LK-------------PEIICGLWHETYLSLA---ILKSSTLITSIYGAIFRNIIAPVI---GISV 270
            |.             |.||    :.||...:   :.|.|..:|.  .||.|..:...:   |:.|
  Rat   216 LPFVSIPEKFFFCFLPTII----NRTYFPFSCGWMNKLSATVTK--WAIMRKSLIQYLQDRGVQV 274

  Fly   271 VF-LSKDEINFHIA-DLWRNVGVRPIVYMVNSPNEKRYF 307
            :| ...:|.:|.:| .|..| ||     |.:.|...|::
  Rat   275 LFWCLNEESDFEVAFSLGAN-GV-----MTDYPTALRHY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 61/287 (21%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 61/286 (21%)
Gdpd3NP_001292116.1 GDPD_GDE4 13..310 CDD:176553 65/299 (22%)
UgpQ 39..311 CDD:223657 61/286 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.