DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GDPD1

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_872375.2 Gene:GDPD1 / 284161 HGNCID:20883 Length:314 Species:Homo sapiens


Alignment Length:318 Identity:63/318 - (19%)
Similarity:118/318 - (37%) Gaps:80/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FWLFCNLAIPWCTLTLLVVCIASKFVKLQRSPNEKRLLSLLSSPEEWPSYWPIANRAAGFDAPEN 96
            |:|...|.....|..||:     |:..|.....::|.||.           .|::|....:..||
Human     7 FYLLSTLGGYLVTSFLLL-----KYPTLLHQRKKQRFLSK-----------HISHRGGAGENLEN 55

  Fly    97 SKAAIKKCLARGYRNVLLDAGLTSCGEIVVAN------PTKINV---------AQPLVELQKLNI 146
            :.||.:..:..|...:.||..:|...::||::      .|.:||         ..|.  |.||::
Human    56 TMAAFQHAVKIGTDMLELDCHITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPY--LGKLDV 118

  Fly   147 TEQHPMGSQYEAETVAPLRQLSDFLEAEAAETT---VFLRLHDN-SARMINELQKFMTADESFTQ 207
            :.|.....:.:...:..|:::     .||...|   :.:::::| ..:.::||.|          
Human   119 SFQRACQCEGKDNRIPLLKEV-----FEAFPNTPINIDIKVNNNVLIKKVSELVK---------- 168

  Fly   208 RTIVISRSPLAIYQLRKLKPEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVIGISVVF 272
               ..:|..|.::  .....||:...:.|. ..:.||.|...:..|.|..|..:: |.:.|...|
Human   169 ---RYNREHLTVW--GNANYEIVEKCYKEN-SDIPILFSLQRVLLILGLFFTGLL-PFVPIREQF 226

  Fly   273 LSKDEINFHIADLWRNVGVRPIVYMVNSPNEKRYFQKTMKIQYLTDSLRSEPHLLMKA 330
            .              .:.:..|:..:..|:.....||.  :.:|:|.|     |:.||
Human   227 F--------------EIPMPSIILKLKEPHTMSRSQKF--LIWLSDLL-----LMRKA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 47/254 (19%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 48/254 (19%)
GDPD1NP_872375.2 GDPD_GDE4 14..311 CDD:176553 60/311 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.