DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and SPAC4D7.02c

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_594955.2 Gene:SPAC4D7.02c / 2543587 PomBaseID:SPAC4D7.02c Length:311 Species:Schizosaccharomyces pombe


Alignment Length:151 Identity:30/151 - (19%)
Similarity:55/151 - (36%) Gaps:39/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSLLSSPEEWPSYWPIANRAAGFDA--PENSKAAIKKCLARGYRNVLLDAGLTSCGEIVVANPTK 131
            |:..|.|       |:.....|:.|  |||:..|.::.:..|...|..|..||....:.:.:...
pombe    25 LATFSKP-------PLVIAHRGYKAKYPENTILAFQQAVKAGADCVETDVRLTKDEVVCILHDRN 82

  Fly   132 IN-VAQPLVELQKLN----------ITEQHPMGSQYE-----------AETVAPLRQLSDFLEAE 174
            :| |....|:::.|:          |.|.|.....||           ...:..::.::|.|   
pombe    83 LNRVFGVDVDVRDLDYELDNGHFRTIQEPHEPLPTYEQFLHELTKHPGVNLLVDIKPVNDLL--- 144

  Fly   175 AAETTVFLRLHDNSARMINEL 195
                 :..|:.|...|:.::|
pombe   145 -----IIPRMVDAMLRVNSDL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 27/137 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 26/136 (19%)
SPAC4D7.02cNP_594955.2 GDPD_YPL206cp_fungi 34..265 CDD:176512 26/135 (19%)
GDPD 37..265 CDD:281062 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R911
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.