DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and Gdpd5

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001349096.1 Gene:Gdpd5 / 233552 MGIID:2686926 Length:612 Species:Mus musculus


Alignment Length:261 Identity:60/261 - (22%)
Similarity:103/261 - (39%) Gaps:86/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VCIASKFVKLQRSPNEKRLLSLLSSPEEWP---SYWPIANRA---AGFDAPE-----NSKAAIKK 103
            :|..::.::|.:. |...||:|...|.:.|   |:..:...|   :||...:     |.:..:.:
Mouse   339 ICSLAELLELAKG-NASLLLNLRDPPRDHPYRGSFLNVTLEAVLRSGFPQHQVMWLFNRQRPLVR 402

  Fly   104 CLARGYRNVLLDAGLTSCGEIVVANPTKINVAQPLVELQKLNITEQHPMGSQYEAETVAPLRQLS 168
            .:|.|::.       ||..:..:||..|.::       ||||:        :|   |....::|.
Mouse   403 KMAPGFQQ-------TSGSKEAIANLRKGHI-------QKLNL--------RY---TQVSHQELR 442

  Fly   169 DFLEAEAAETTVFLRLHDNSARMINEL-----QKFMTADESFTQRTIVISR--SPLAIYQLRKLK 226
            |:     |...:.:.|:..:|..:..|     ...:|:|.|.|     :||  |||.|     :.
Mouse   443 DY-----ASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT-----LSRVPSPLWI-----MP 492

  Fly   227 PEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVIGISVVFLSKDEINFHIADLWRNVGV 291
            |:..|.:|     ..|.|.|.:||               |||.|:      .|:|:. .||..|:
Mouse   493 PDEYCLMW-----VTADLISFSLI---------------IGIFVL------QNYHLI-RWRLGGI 530

  Fly   292 R 292
            |
Mouse   531 R 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 51/225 (23%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 51/224 (23%)
Gdpd5NP_001349096.1 PI-PLCc_GDPD_SF 227..581 CDD:387364 60/261 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.