DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and GDPD4

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_011543136.1 Gene:GDPD4 / 220032 HGNCID:24849 Length:649 Species:Homo sapiens


Alignment Length:378 Identity:73/378 - (19%)
Similarity:131/378 - (34%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YWRLLWLALKMIYQLLCCSVSLIFFCFNVFW------------LFCNLAIPWCTLTLLVVCIASK 55
            :|.:..|:|..|  |...|..|:...|.:.|            :...|.|..|.:.:.::|   |
Human    55 FWSIFILSLARI--LTAYSSLLLLLGFLLLWERIELYLHLCHKILILLVILLCVILMFIIC---K 114

  Fly    56 FVKLQRSPNEKRLLSLLSSPEEWP------------SYWPIA---------NRAAGFDAPENSKA 99
            |.|      |:.|::.||.....|            .:||:|         .|...:....:.|.
Human   115 FWK------ERWLVAGLSMQIFAPYVHLVSITVMVILFWPVAFYVACLEREVRMRRYRMTHSEKK 173

  Fly   100 AIKKC-LARGYRNVLLDAGLTSCGEIVVANPTKINVAQPLVELQKLNITEQHPMGSQYEAETVAP 163
            .:|:| :....|.:.:..||.....::......:.:..|.:: :|.|:..:..:.....|..:.|
Human   174 RLKQCNVITRLRGLQVPVGLPFLLILLGLYLMPLGIYSPCIQ-EKENLGPKPTIFGHRGAPMLGP 237

  Fly   164 LRQLSDFLE-----AEAAETTVFLR-------LHDNSARM---INELQKFMTADESFTQRTIVIS 213
            ...:..|.:     |...||.:.|.       :||...:.   |.|:|     .||..:.....:
Human   238 ENTMMSFEKAVEHGAHGLETDIHLSYDHVPFLMHDFDLKRTTNIGEVQ-----PESACENPAFFN 297

  Fly   214 RSPLAIYQLRK--LKPEIICGLWHETYLSLAILKSSTLITSIYGAIFRNIIAPVIGISVVFLSKD 276
            ...|:.....|  :|||:      ..:.::..|..:....:      ||...|.:. .::.|::.
Human   298 WDFLSTLNAGKWFVKPEL------RPFYNMKPLSEADKERA------RNQSIPTLA-DLLTLAEK 349

  Fly   277 EINFHIADLWRNVGVRPIVYMVNSPNEKRYFQKTMKIQYLTDSLRS--EPHLL 327
            |..|.|.||.|             |..|...:.|...|.::..|.|  |.||:
Human   350 ERKFVIFDLHR-------------PPPKHPLRHTFVRQVVSVILASKIEQHLI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 46/262 (18%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 45/262 (17%)
GDPD4XP_011543136.1 PI-PLCc_GDPD_SF 205..517 CDD:301322 42/217 (19%)
UgpQ 223..482 CDD:223657 39/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.