DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and T09B9.3

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_509638.2 Gene:T09B9.3 / 188321 WormBaseID:WBGene00011644 Length:340 Species:Caenorhabditis elegans


Alignment Length:357 Identity:64/357 - (17%)
Similarity:142/357 - (39%) Gaps:85/357 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLWLALKMIYQLLCCSVSLIFFCFNVFWLFCNLAIPWCTLTLLVVCIASKFVKLQRSPNEKRLLS 70
            |:|..:.::..||.| :::.|....:.     ||:    |..|.:.::..|..|:|||.::    
 Worm     5 LIWFIVIVLIALLAC-LAIKFLALRIV-----LAL----LLTLPILLSVAFCVLRRSPVQE---- 55

  Fly    71 LLSSPEEWPSYWPIANRAAGFDAP--------------ENSKAAIKKCLARGYRNVLLDAGLTSC 121
                          :|:|..|:|.              :|:..|.::....|...:::|..:|..
 Worm    56 --------------SNKAVFFNATSIISDRGEAHGSVHKNTIPAFRQAKQNGADTIVMDVRMTKD 106

  Fly   122 GEIVVANPTKINVAQPL--------VELQKLNITEQHPMGSQYEAETVAPLRQLSDFLEA----E 174
            |.::|..|..::.....        :::.:||:         |.......|    .|.||    |
 Worm   107 GMLIVLLPDSVDTDNATYIVDETHWIQMSQLNV---------YGGNNGTIL----TFDEAVSWCE 158

  Fly   175 AAETTVFLRLHDNSARMINELQKFMTADESFTQRTIVISRSPLAIYQLRKLKPEIICG-LWHETY 238
            |.:..:...:...|:.::..|:..:..| |...:..|.:.:.:|..::|....:::.| :|..|.
 Worm   159 ANKMNMIWHIPSFSSDLLTYLRNKIMQD-SLYDKVAVTTYNLIAAGRIRCTDRQLLMGMIWKSTE 222

  Fly   239 LSLAILKSSTLITSIYGAIF------------RNIIAP-VIGISVVFLSKDEINFHIADLWRNVG 290
            .|:.   :.|.:.::|.:.:            |:::.| .:|:..:..|.|:.:..:.......|
 Worm   223 YSIV---NGTAVGNMYTSWYYSMMDTFTYWGIRSLLLPSFLGVDFLVTSVDDADRALIVESSASG 284

  Fly   291 VRPIVYMVNSPNEKRYFQKTMKIQYLTDSLRS 322
            :|.|:|.:.:..|:.||...|::..:.:.|.|
 Worm   285 MRTIIYDMETATERNYFANQMELPMIVNDLVS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 47/275 (17%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 47/275 (17%)
T09B9.3NP_509638.2 GDPD_GDE1 67..314 CDD:176515 43/263 (16%)
GDPD 81..311 CDD:281062 43/246 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41149
Inparanoid 1 1.050 49 1.000 Inparanoid score I4115
Isobase 1 0.950 - 0 Normalized mean entropy S4508
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002161
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.