DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14883 and gdpd4a

DIOPT Version :9

Sequence 1:NP_650547.1 Gene:CG14883 / 41997 FlyBaseID:FBgn0038432 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002665330.3 Gene:gdpd4a / 100333025 ZFINID:ZDB-GENE-091204-436 Length:600 Species:Danio rerio


Alignment Length:337 Identity:68/337 - (20%)
Similarity:120/337 - (35%) Gaps:112/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRLLWLALKMIYQLLCCSVSLIFFCFNVFWLFCNLAIPWCTLTLLVVCIASKFVKLQRSPNEKRL 68
            |...|..|.:.:|:..              .|.:|. ..|.:|||...||..|.::.:...:..:
Zfish   164 WSKEWTTLLLSFQVTA--------------PFLHLG-GVCIMTLLSWPIALHFFRMNKRVRQVLI 213

  Fly    69 LSL--------------LSSP---EE---WPSYWPIANRAAGFDAPENSKAAIKKCLARGYRNVL 113
            |||              :.||   ||   .|:...|.:|.|...||||::.:.:|.:..|...:.
Zfish   214 LSLYLAVLFALYLVPLGMYSPCIKEEGTLGPAPTLIGHRGAPMLAPENTQMSFEKAVEAGGEGLE 278

  Fly   114 LDAGLTSCG------EIVVANPTKINVAQP-----------LVELQ------------------K 143
            .|..::..|      :..:...|.::...|           ..||:                  .
Zfish   279 TDVAISYDGVPFLMHDSTLRRTTNVHEVFPNRTDSPAAMFTWAELEMLSAGSWFLRRDPFRTASS 343

  Fly   144 LNITEQHPMGSQYEAETVAPLRQLSDFLEAEAAETTVF-LR-------------------LHDNS 188
            ||:.|:    .:.:.:||..|::..: |.|:.....:| ||                   :|:.|
Zfish   344 LNVNEK----IEVQNQTVPTLKEFLN-LAAQHQSLVIFDLRRPPRGHPYRDTWITRTLEVIHNES 403

  Fly   189 ARMINELQKFMTADESFTQRTIVISRSPLAIYQ-------LRKLKPEIICGL-WHETYLSLAILK 245
              .||..|.....|:   ||::|....| .:.|       :.:|:.|.|..| .|.:|:|...::
Zfish   404 --FINSSQVLWLPDD---QRSVVQELDP-ELQQTSGDHASIEELQEEHIVRLNLHYSYMSQEQIR 462

  Fly   246 ---SSTLITSIY 254
               |..:.|::|
Zfish   463 KYASVNISTNLY 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14883NP_650547.1 UgpQ 83..319 CDD:223657 47/238 (20%)
PI-PLCc_GDPD_SF 84..320 CDD:301322 47/237 (20%)
gdpd4aXP_002665330.3 PI-PLCc_GDPD_SF 224..539 CDD:301322 52/262 (20%)
UgpQ 246..522 CDD:223657 47/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.