DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:121/262 - (46%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWA 72
            |.|....|..|         |:|...|.:||.|....:...|||:||.....|.||.|::|..|.
Mouse     4 ITFFTFLGAAV---------ALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWV 59

  Fly    73 ITAAHCIDGHEQQPREFTLRQG--SIMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADG 133
            ::||||      ..|...:|.|  :|....||. |.:.|  |.:||.|::..::.|:.|::....
Mouse    60 LSAAHC------YKRRLQVRLGEHNIDVLEGGE-QFIDAEKIIRHPDYNKDTVDNDIMLIKLKSP 117

  Fly   134 ALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRH 198
            |:.  ..:|:.:.||.  ...|.:...:|||||:..:......::|:......::...|...  :
Mouse   118 AIL--NSQVSTVSLPR--SCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS--Y 176

  Fly   199 HGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRW 261
            .|.:|..|||..  ....|:|.||||||:...|.:.||||||..||....|||||::.:  ...|
Mouse   177 PGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN--YLSW 239

  Fly   262 IR 263
            |:
Mouse   240 IQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/231 (31%)
Tryp_SPc 37..263 CDD:238113 72/231 (31%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 71/231 (31%)
Tryp_SPc 24..243 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.