DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss55

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:252 Identity:87/252 - (34%)
Similarity:124/252 - (49%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRT 99
            |||:.|:||..|:||:|:|::....|.||.||||..|.:|.|||....|..|.:..:|.|:...|
Mouse    59 SRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLT 123

  Fly   100 SGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAV 161
            :......|..|.:|..:.|.:|:.|:|||     .|:.||   ....||.||.        .||.
Mouse   124 TSPVELEVTTIIRHKGFKRLNMDNDIALL-----LLAKPLTFNELTVPICLPL--------WPAP 175

  Fly   162 -------VSGWG-HMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNT--DA 216
                   |:||| ..||....:|:.|....:..:..|:|   |:....:|..|.||:..|.  ||
Mouse   176 PSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEEC---LQMFPSLTTNMLCASYGNESYDA 237

  Fly   217 CQGDSGGPI------SAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTK 267
            ||||||||:      .::...:||:|||..|....:||:||.||..|:  ||..:.:
Mouse   238 CQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTL--WIEKIAQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 84/244 (34%)
Tryp_SPc 37..263 CDD:238113 84/244 (34%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 84/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.