DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk12

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:265 Identity:86/265 - (32%)
Similarity:123/265 - (46%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCID 80
            ||::|.|    ..:.:....:|.||.|..:...|:|:.|.......||..::...|.:|||||.|
Mouse     5 ILLLLCA----VGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHCRD 65

  Fly    81 GHEQQPREFTLRQGSIMRTSGGTVQPVKAI---YKHPAYDRADMN--FDVALLRTADGALSLPL- 139
                   ::.:|.|....|.....:.::..   ..||:|..|..|  .|:.|||     |:.|: 
Mouse    66 -------KYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLR-----LNRPIH 118

  Fly   140 --GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNP--VLSSVLKSTTVLTVNQEKCHNDLRHHG 200
              ..|.|:.||:  ..::......|||||  :|:.|  .....|:...:.||:.|.|.  ....|
Mouse   119 LTRAVRPVALPS--SCVTTGAMCHVSGWG--TTNKPWDPFPDRLQCLNLSTVSNETCR--AVFPG 177

  Fly   201 GVTEAMFCAAAR-NTDACQGDSGGPISAQGTLIGIVSWG-VG-CADPYYPGVYTRLAHPTIRRWI 262
            .|||.|.||... ..||||||||||:...|.|.|:|||| || |.....|||||::...|  .||
Mouse   178 RVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYT--DWI 240

  Fly   263 RLLTK 267
            |::.:
Mouse   241 RIVIR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/238 (33%)
Tryp_SPc 37..263 CDD:238113 80/238 (34%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.