DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:118/260 - (45%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ||...|..|.|...        ..|.:||.|........|||:|| ....|.||.|:::|.|.::
Mouse     6 FLAFLGAAVALPLD--------DDDDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWVVS 61

  Fly    75 AAHCIDGHEQQPREFTLRQGSIMRTSGGT--VQPVKAIYKHPAYDRADMNFDVALLRTADGA-LS 136
            ||||.....|    ..|.:.:|....||.  :...| |.:||.|:....|.|:.|::....| |:
Mouse    62 AAHCYKSRIQ----VRLGEHNIDALEGGEQFIDAAK-IIRHPNYNANTYNNDIMLIKLKTAATLN 121

  Fly   137 LPLGKVA-PIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG 200
            ..:..|| |...|:.|..      .:|||||:..:|.....|:|:......::...|.:.  :.|
Mouse   122 SRVSTVALPRSCPSAGTR------CLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSS--YPG 178

  Fly   201 GVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            .:|..|||..  ....|:||||||||:...|.|.|:||||.|||....|||||::....  .||:
Mouse   179 KITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYV--NWIQ 241

  Fly   264  263
            Mouse   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/231 (33%)
Tryp_SPc 37..263 CDD:238113 77/231 (33%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 76/231 (33%)
Tryp_SPc 25..243 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.