DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and prss1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:267 Identity:87/267 - (32%)
Similarity:125/267 - (46%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            |:|:|...|      ..||.....|.:||.|.|.|:...|||:|| ....|.||.|::|:.|.::
Zfish     4 FILLALFAV------AYAAPLGDDDDKIVGGYECTKNGVPYQVSL-NSGYHFCGGSLISNLWVVS 61

  Fly    75 AAHCIDGHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGA-- 134
            ||||.....|      :|.|. .:..:.||.|.:.:  :.:||:|:...::.||.|::.:..|  
Zfish    62 AAHCYKSRVQ------VRLGEHNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQI 120

  Fly   135 ------LSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCH 193
                  :|||            ....|.....::||||:||.|.....|.|.......::...|.
Zfish   121 NSYVKTVSLP------------SSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCR 173

  Fly   194 NDLRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHP 256
            |  .:.|.::..||||.  ....|:||||||||:.....|.||||||.|||....||||.::.:.
Zfish   174 N--AYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNF 236

  Fly   257 TIRRWIR 263
            |  .|||
Zfish   237 T--TWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/238 (32%)
Tryp_SPc 37..263 CDD:238113 78/238 (33%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 77/238 (32%)
Tryp_SPc 25..243 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.