DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS56

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:256 Identity:79/256 - (30%)
Similarity:118/256 - (46%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPRE 88
            |...|...:...|||.|..|..|.:|:.:.|:.....:||..:::::|.:|||||..|   .|.|
Human    92 RPSTANVTRAHGRIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCFVG---APNE 153

  Fly    89 F----TLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIR 146
            .    ||.:||  |.......||..|..||.:|....:.|:||::     |..|:   |...|:.
Human   154 LLWTVTLAEGS--RGEQAEEVPVNRILPHPKFDPRTFHNDLALVQ-----LWTPVSPGGSARPVC 211

  Fly   147 LPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA- 210
            ||...:.........::|||.:....|...:| :...|..::.:.|...| ..|.....|.||. 
Human   212 LPQEPQEPPAGTACAIAGWGALFEDGPEAEAV-REARVPLLSTDTCRRAL-GPGLRPSTMLCAGY 274

  Fly   211 -ARNTDACQGDSGGPISA-------QGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
             |...|:||||||||::.       :..|.|:.|||.||.:|..||||||:|  ..:.|::
Human   275 LAGGVDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVA--VFKDWLQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/241 (32%)
Tryp_SPc 37..263 CDD:238113 76/241 (32%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96 1/3 (33%)
Tryp_SPc 105..335 CDD:238113 76/243 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.