DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG17239

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:229 Identity:89/229 - (38%)
Similarity:122/229 - (53%) Gaps:16/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREF-TLRQGSIMRT 99
            |||.|...|....|:|.|:.|.....|||:|.|.:..||||||:...|   .|| ::|.||....
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRE---TEFLSVRVGSSFTF 84

  Fly   100 SGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESMPAVVSG 164
            .||.|..|.::..|..||::..| |:|::|...   .|.||....: :|......:...||.|||
  Fly    85 FGGQVVRVSSVLLHEEYDQSWSN-DIAVMRLQS---KLRLGSAVSV-IPLADTPPASGSPATVSG 144

  Fly   165 WGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG-GVTEAMFCAAARNTDACQGDSGGPISAQ 228
            ||.:........|:| |.:|..|:|::|.   |.:| .:|:.|.||||...|||.||||||:.:.
  Fly   145 WGAIGFKKNYPMSIL-SASVDIVDQDQCR---RSYGRKITKDMICAAAPGKDACSGDSGGPLVSG 205

  Fly   229 GTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            ..|:||||:|..||.|.|||||..:|.  ::.||
  Fly   206 NKLVGIVSFGKECAHPEYPGVYANVAE--LKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 87/227 (38%)
Tryp_SPc 37..263 CDD:238113 88/228 (39%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 87/227 (38%)
Tryp_SPc 24..237 CDD:238113 86/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443398
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.