DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG34458

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:236 Identity:79/236 - (33%)
Similarity:126/236 - (53%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMR 98
            :|||:.|:.|..||||:|:||:....|.||.|::|....:|||||..|  |.|.:.....|:...
  Fly    29 ESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMG--QNPGQMKAIVGTNDL 91

  Fly    99 TSG-GTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMP 159
            ::| |....:.....||.|:....:||::|::     ||.|:   |.|..|:|.......:....
  Fly    92 SAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIK-----LSSPVPMGGAVQTIQLADSDSNYAADTM 151

  Fly   160 AVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGDSG 222
            |::||:|.:: .|..|.:.||...|...:::.|::  ::..|:|:.|.||.  :....:||||||
  Fly   152 AMISGFGAIN-QNLQLPNRLKFAQVQLWSRDYCNS--QNIPGLTDRMVCAGHPSGQVSSCQGDSG 213

  Fly   223 GPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            ||::..|.|.|:||||.||.....|.:||.:.  .:|.||:
  Fly   214 GPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVG--ALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/231 (33%)
Tryp_SPc 37..263 CDD:238113 76/231 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 76/231 (33%)
Tryp_SPc 32..254 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.