DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:261 Identity:68/261 - (26%)
Similarity:113/261 - (43%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQ-TVHICGASILSSNWAIT 74
            |.:|..|..:.....|:. .|.|  |::.|..|..||||..:|:... .|| ||.:::.....:|
Mosquito     8 LCLAVALPCIRGDNVESE-DRSP--RLIGGTNAPWGQFPSAVSINTTFNVH-CGGAVVDRQHVLT 68

  Fly    75 AAHCIDGHEQQ---PREFTLRQGSIMRTSGGT---VQPVKAIYKHPAYDRADMNFDVALLRTADG 133
            ||.|:.....:   |...|:|.|.|.....|.   .:.|..|:.||.::...:..|||:|| .|.
Mosquito    69 AAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEHDVAVLR-LDR 132

  Fly   134 ALSLPLGKVAPIRLPTVGEA------ISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVN-QEK 191
            ...||..        |:..|      :........:|||..:.:.....:||:....:||| ::.
Mosquito   133 PYDLPSN--------TINLANRTRRIVPNGASCQFAGWGASTAALNAPVNVLQRFLPMTVNDRDM 189

  Fly   192 CHNDLRHHGGVTEAMFCA----AARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTR 252
            |:....|.|.:.|:..||    .:.|...|.|::|..:..:..|:|.:|:|:.|.....|.|:|:
Mosquito   190 CNQANMHAGRMLESHLCAGNTGGSNNAAPCNGNAGTGLYCERALVGTLSFGLNCGAANNPPVFTQ 254

  Fly   253 L 253
            :
Mosquito   255 V 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 62/236 (26%)
Tryp_SPc 37..263 CDD:238113 61/235 (26%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 62/236 (26%)
Tryp_SPc 32..265 CDD:238113 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.