DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk11

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:243 Identity:71/243 - (29%)
Similarity:122/243 - (50%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMR 98
            ::||:.|.|......|:|::|.::|..:|||::::..|.:|||||...|    ....|.:.::.:
Mouse    45 ETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPH----YVILLGEHNLEK 105

  Fly    99 TSGGTVQPVKA-IYKHPAYDRA----DMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAIS 155
            |.|...:.:.. .:.||.::.:    |...|:.|::     :|.|:   ..|.|:.|..  ..::
Mouse   106 TDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVK-----MSSPVFFTRAVQPLTLSP--HCVA 163

  Fly   156 ESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAAR--NTDACQ 218
            .....::||||..|:....|...|:...|..:..::|  :..:.|.:|:.|.||:.|  ..|:||
Mouse   164 AGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKEC--EKAYPGNITDTMLCASVRKEGKDSCQ 226

  Fly   219 GDSGGPISAQGTLIGIVSWGVG-CADPYYPGVYTRLA------HPTIR 259
            ||||||:...|:|.||:|||.. ||....|||||::.      |..:|
Mouse   227 GDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNWIHEVMR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/241 (29%)
Tryp_SPc 37..263 CDD:238113 70/240 (29%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 69/234 (29%)
Tryp_SPc 48..272 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.