DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS8

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:277 Identity:92/277 - (33%)
Similarity:134/277 - (48%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPFLLIAGILVI-LEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNW 71
            :..||..|:|.. ..|...||.....|.:||..|..|..||:|:|:|:..:.||:||.|::|..|
Human    15 VAILLYLGLLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQW 79

  Fly    72 AITAAHCIDG-HEQQPREFTLRQGSI-MRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGA 134
            .::||||... |.::..|..|....: ..:....|..:|.|..||:|.:.....|:|||:     
Human    80 VLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQ----- 139

  Fly   135 LSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLS-SVLKSTTVLTVNQEKCH-- 193
            ||.|:   ..:.||.||....:....:...|:||||::.|..:|: ..|:...|..:::|.|:  
Human   140 LSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCL 204

  Fly   194 ------NDLRHHGGVTEAMFCA--AARNTDACQGDSGGPIS--AQGT--LIGIVSWGVGCADPYY 246
                  .:..|.  |.|.|.||  .....||||||||||:|  .:|.  |.||||||..|.....
Human   205 YNIDAKPEEPHF--VQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNR 267

  Fly   247 PGVYTRLAHPTIRRWIR 263
            |||||..:  :...||:
Human   268 PGVYTLAS--SYASWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/245 (33%)
Tryp_SPc 37..263 CDD:238113 82/245 (33%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 82/245 (33%)
Tryp_SPc 45..284 CDD:238113 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.