DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:185 Identity:63/185 - (34%)
Similarity:89/185 - (48%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GTVQPVK--AIYKHPAYDRADMNFDVALLRTADGALSLPLG-----KVAPIRLPTVGEAISESMP 159
            ||.|..|  .:..||.|:|:..|.|:.|::     ||.|:.     .:||  ||.....:.....
Zfish    18 GTEQYSKPLMLIPHPLYNRSTNNADIMLIK-----LSAPIELNRYVSLAP--LPKQNTGLLAGRM 75

  Fly   160 AVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCA--------AARNTD- 215
            ..|||||..|.|..::...|::..:..|:..||::.....|.:|..|.||        |.:|:. 
Zfish    76 CRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQ 140

  Fly   216 --------ACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
                    .||||||||:...|.:.|:||||.||.||.:|||||.::.  .||||
Zfish   141 YLCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAVSR--FRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 61/183 (33%)
Tryp_SPc 37..263 CDD:238113 63/185 (34%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 63/185 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.