DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS3

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:255 Identity:85/255 - (33%)
Similarity:122/255 - (47%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDG 81
            |.|...:....|||...|.:||.|....|...|||:||...: |.||.|::|..|.::||||...
Human    90 LPIRNQNELGVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGS-HFCGGSLISEQWVVSAAHCYKT 153

  Fly    82 HEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPL---G 140
            ..|      :|.|. .::...|..|.:.|  |.:||.|:|..::.|:.|::     ||.|.   .
Human   154 RIQ------VRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIK-----LSSPAVINA 207

  Fly   141 KVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEA 205
            :|:.|.|||...|....  .::||||:..:........||......:.|.:|  ...:.|.:|.:
Human   208 RVSTISLPTTPPAAGTE--CLISGWGNTLSFGADYPDELKCLDAPVLTQAEC--KASYPGKITNS 268

  Fly   206 MFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            |||..  ....|:||.|||||:...|.|.|:||||.|||....|||||::.:..  .||:
Human   269 MFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYV--DWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/233 (33%)
Tryp_SPc 37..263 CDD:238113 78/233 (33%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 77/233 (33%)
Tryp_SPc 110..328 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.