DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS2

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:265 Identity:87/265 - (32%)
Similarity:128/265 - (48%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHC-- 78
            :|:||.......|.|...|.:||.|....|...|||:|| ....|.||.|::|..|.::|.||  
Human     3 LLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISEQWVVSAGHCYK 66

  Fly    79 ------IDGHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGA 134
                  :.|...:.....:|.|. .:....|..|.:.|  |.:||.|:...::.|:.|::     
Human    67 SAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIK----- 126

  Fly   135 LSLPL---GKVAPIRLPTVGEAI-SESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHND 195
            ||.|.   .:|:.|.|||...|. :||:   :||||:..:|.......|:......::|.:|  :
Human   127 LSSPAVINSRVSAISLPTAPPAAGTESL---ISGWGNTLSSGADYPDELQCLDAPVLSQAEC--E 186

  Fly   196 LRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTI 258
            ..:.|.:|..|||..  ....|:||||||||:.:.|.|.||||||.|||....|||||::.:.. 
Human   187 ASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYV- 250

  Fly   259 RRWIR 263
             .||:
Human   251 -DWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/242 (33%)
Tryp_SPc 37..263 CDD:238113 80/242 (33%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 79/242 (33%)
Tryp_SPc 24..256 CDD:238113 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.