DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:252 Identity:85/252 - (33%)
Similarity:124/252 - (49%) Gaps:20/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDG 81
            |:||.......|.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::|.||...
Human   229 LLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSAGHCYKS 292

  Fly    82 HEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPLGKVA 143
            ..|      :|.|. .:....|..|.:.|  |.:||.|||..:|.|:.|::.:..|:.  ..:|:
Human   293 RIQ------VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVI--NARVS 349

  Fly   144 PIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFC 208
            .|.|||...|....  .::||||:.::|.......|:......::|.||  :..:.|.:|..|||
Human   350 TISLPTAPPATGTK--CLISGWGNTASSGADYPDELQCLDAPVLSQAKC--EASYPGKITSNMFC 410

  Fly   209 AA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            ..  ....|:||||||||:...|.|.|:||||.|||....|||||::.:..  :||:
Human   411 VGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYV--KWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/230 (33%)
Tryp_SPc 37..263 CDD:238113 78/230 (34%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 77/230 (33%)
Tryp_SPc 249..467 CDD:238113 79/232 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.