DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:276 Identity:87/276 - (31%)
Similarity:127/276 - (46%) Gaps:56/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQT-VHICGASILSSNWAIT 74
            ||:..:|.||..|..:..     .:|||.|.........|.:|::..| .|.||.::::..|.:|
Zfish     6 LLLCVLLEILAVSCQDVI-----QARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLT 65

  Fly    75 AAHC------------------IDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADM 121
            ||||                  .:|.||..|...|                   ..||.|||:..
Zfish    66 AAHCNIGEANMRIVAGDYSVGLYEGMEQFRRPHML-------------------IPHPQYDRSTN 111

  Fly   122 NFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTT 183
            |.|:.|::     |..|:   ..|:.:.||.....::......||||| .:||...:||:|::..
Zfish   112 NADIMLIK-----LQSPVYLNSYVSLVPLPRQDAMVAVGRLCSVSGWG-FTTSTGGISSILRTVK 170

  Fly   184 VLTVNQEKCHNDLRHHGGVTEAMFCA--AARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYY 246
            :..|:...|:.....:|.:||.|.||  :....|||:||||||:..:|.:.||||||.||||..|
Zfish   171 LPIVSTAVCNGTDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQY 235

  Fly   247 PGVYTRLAHPTIRRWI 262
            |||||.::.  .|:||
Zfish   236 PGVYTAVSQ--FRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/249 (32%)
Tryp_SPc 37..263 CDD:238113 80/250 (32%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 79/249 (32%)
Tryp_SPc 27..252 CDD:238113 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.